PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D00652.1.p
Common NameEUGRSUZ_D00652, LOC104441041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 269aa    MW: 29911.5 Da    PI: 8.9745
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D00652.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1161.6e-361472260
            zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                      +++ lkcprCdstntkfCyynny+ sqPr+fCkaC+r+WtkGG+lrnvPvGggr++++ 
  Eucgr.D00652.1.p 14 PSEPLKCPRCDSTNTKFCYYNNYNKSQPRHFCKACKRHWTKGGTLRNVPVGGGRKNKRP 72
                      67899***********************************************9876664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-231571IPR003851Zinc finger, Dof-type
PfamPF027011.2E-311770IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.6431872IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102056IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MKRPLQQQNQ LNQPSEPLKC PRCDSTNTKF CYYNNYNKSQ PRHFCKACKR HWTKGGTLRN  60
VPVGGGRKNK RPKPSHPSSA AANSSSAASR RILTANTTTA SDAPVQAREK IIRGLQSEVC  120
DQKDLNEMFY QAFLFQPPPR ENLCSNSNIF LGSSLSTPES ANLHFPLLQS SSPLVRNTCS  180
STPISSFGFS STVDGQTREY KPVLEESSTI ITTSVMPTST CTQPWNFGNI GMEVMNNTSH  240
NWVWDDMDKL VSTNLSLPDW DNVETKPQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D00652.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052347.10.0PREDICTED: dof zinc finger protein DOF1.8-like isoform X2
RefseqXP_010052346.10.0PREDICTED: dof zinc finger protein DOF1.8-like isoform X1
TrEMBLA0A059CDL10.0A0A059CDL1_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.12e-29Dof family protein